"CRBN" Related Products

Expand
Expand
Expand

Recombinant Human CRBN protein, His-b2m-tagged

Cat.No.: CRBN-15H
Product Overview: Recombinant Human CRBN(1-442 aa) fused with His-b2m tag was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His-b2m
Form: 20mM Tris-HCl based buffer,pH8.0
Molecular Mass: 62.83kD
Protein length: 1-442 aa
AA Sequence: MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQV IPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAI GRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSW PRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTS LCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGW KFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: CRBN cereblon [ Homo sapiens ]
Official Symbol: CRBN
Synonyms: CRBN; cereblon; mental retardation, non syndromic, autosomal recessive, 2A , MRT2A; protein cereblon; protein x 0001; MRT2; MRT2A; MGC27358; DKFZp781K0715;
Gene ID: 51185
mRNA Refseq: NM_001173482
Protein Refseq: NP_001166953
MIM: 609262
UniProt ID: Q96SW2
Chromosome Location: 3p26.3
Function: ATP-dependent peptidase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.