Recombinant Human CRCP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CRCP-4225H
• Product Overview: CRCP MS Standard C13 and N15-labeled recombinant protein (NP_055293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Molecular Mass: 16.7 kDa
• AA Sequence: MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CRCP CGRP receptor component [ Homo sapiens (human) ]
• Official Symbol: CRCP
• Synonyms: CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194
• Gene ID: 27297
• mRNA Refseq: NM_014478
• Protein Refseq: NP_055293
• MIM: 606121
• UniProt ID: O75575