Recombinant Human CRCP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CRCP-4225H
Product Overview : CRCP MS Standard C13 and N15-labeled recombinant protein (NP_055293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Mass : 16.7 kDa
AA Sequence : MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CRCP CGRP receptor component [ Homo sapiens (human) ]
Official Symbol CRCP
Synonyms CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194;
Gene ID 27297
mRNA Refseq NM_014478
Protein Refseq NP_055293
MIM 606121
UniProt ID O75575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRCP Products

Required fields are marked with *

My Review for All CRCP Products

Required fields are marked with *

0
cart-icon
0
compare icon