Recombinant Human CRELD2, His-tagged

• Cat.No.: CRELD2-74H
• Product Overview: Recombinant Human Cysteine-Rich with EGF-Like Domain Protein 2/CRELD2 is produced by our mammalian expression system. The target protein is expressed with sequence (Ala25-Leu353) of Human CRELD2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 25-353 a.a.
• Description: Cysteine-Rich with EGF-Like Domain Protein 2 (CRELD2) is a secreted protein that is a member of the CRELD family. Human CRELD2 is synthesized as a 353 amino acid precursor protein with a signal peptide, a highly conserved domain rich in glutamic acid and tryptophan (WE) and EGF-like repeats. CRELD2 is ubiquitously expressed in many tissues. CRELD2 may interact with CHRNA4 and regulate transport of α4-β2 neuronal acetylcholine receptor. In addition, CRELD2 could be a novel mediator in regulating the onset and progression of various ER stress-associated diseases.
• AA Sequence: AKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFE CNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHC SGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEV GWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEDVDECSLAEKTCVRKNENCYNTPGSYV CVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDLVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: CRELD2 cysteine-rich with EGF-like domains 2 [ Homo sapiens ]
• Official Symbol: CRELD2
• Synonyms: CRELD2; cysteine-rich with EGF-like domains 2; cysteine-rich with EGF-like domain protein 2; MGC11256; DKFZp667O055
• Gene ID: 79174
• mRNA Refseq: NM_001135101
• Protein Refseq: NP_001128573
• MIM: 607171
• UniProt ID: Q6UXH1
• Chromosome Location: 22q13.33
• Function: calcium ion binding; protein binding