Recombinant Human CRELD2, His-tagged

Cat.No. : CRELD2-74H
Product Overview : Recombinant Human Cysteine-Rich with EGF-Like Domain Protein 2/CRELD2 is produced by our mammalian expression system. The target protein is expressed with sequence (Ala25-Leu353) of Human CRELD2 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 25-353 a.a.
Description : Cysteine-Rich with EGF-Like Domain Protein 2 (CRELD2) is a secreted protein that is a member of the CRELD family. Human CRELD2 is synthesized as a 353 amino acid precursor protein with a signal peptide, a highly conserved domain rich in glutamic acid and tryptophan (WE) and EGF-like repeats. CRELD2 is ubiquitously expressed in many tissues. CRELD2 may interact with CHRNA4 and regulate transport of α4-β2 neuronal acetylcholine receptor. In addition, CRELD2 could be a novel mediator in regulating the onset and progression of various ER stress-associated diseases.
AA Sequence : AKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYESSEIRLLEILEGLCESSDFE CNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHC SGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEV GWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEDVDECSLAEKTCVRKNENCYNTPGSYV CVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CRELD2 cysteine-rich with EGF-like domains 2 [ Homo sapiens ]
Official Symbol CRELD2
Synonyms CRELD2; cysteine-rich with EGF-like domains 2; cysteine-rich with EGF-like domain protein 2; MGC11256; DKFZp667O055;
Gene ID 79174
mRNA Refseq NM_001135101
Protein Refseq NP_001128573
MIM 607171
UniProt ID Q6UXH1
Chromosome Location 22q13.33
Function calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRELD2 Products

Required fields are marked with *

My Review for All CRELD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon