Recombinant Human CRH protein, T7-tagged
Cat.No. : | CRH-217H |
Product Overview : | Recombinant human CRH fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQENGRGEFLLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPA APLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPI SLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK |
Purity : | >90% by SDS-PAGE. |
Applications : | 1. Active protein, may be used for in vitro corticotropin regulation study.2. Potential biomarker protein for PPD diagnosis applications.3. As immunogen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | CRH corticotropin releasing hormone [ Homo sapiens ] |
Official Symbol | CRH |
Synonyms | CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor; |
Gene ID | 1392 |
mRNA Refseq | NM_000756 |
Protein Refseq | NP_000747 |
MIM | 122560 |
UniProt ID | P06850 |
Chromosome Location | 8q13 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
Function | corticotropin-releasing hormone activity; corticotropin-releasing hormone receptor 1 binding; corticotropin-releasing hormone receptor 2 binding; hormone activity; neuropeptide hormone activity; protein binding; receptor binding; |
◆ Recombinant Proteins | ||
CRH-3048H | Recombinant Human Corticotropin Releasing Hormone, T7-tagged | +Inquiry |
Crh-7794R | Recombinant Rat Crh protein, His & GST-tagged | +Inquiry |
CRH-3836C | Recombinant Chicken CRH | +Inquiry |
Crh-7564M | Recombinant Mouse Crh protein, His-KSI-tagged | +Inquiry |
CRH-108H | Recombinant Human CRH, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CRH-107H | Recombinant Full Length Human CRH Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRH-7281HCL | Recombinant Human CRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRH Products
Required fields are marked with *
My Review for All CRH Products
Required fields are marked with *