Recombinant Human CRH protein, T7-tagged

• Cat.No.: CRH-217H
• Product Overview: Recombinant human CRH fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQENGRGEFLLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPA APLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPI SLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
• Purity: >90% by SDS-PAGE.
• Applications: 1. Active protein, may be used for in vitro corticotropin regulation study.2. Potential biomarker protein for PPD diagnosis applications.3. As immunogen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: CRH corticotropin releasing hormone [ Homo sapiens ]
• Official Symbol: CRH
• Synonyms: CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor
• Gene ID: 1392
• mRNA Refseq: NM_000756
• Protein Refseq: NP_000747
• MIM: 122560
• UniProt ID: P06850
• Chromosome Location: 8q13
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem
• Function: corticotropin-releasing hormone activity; corticotropin-releasing hormone receptor 1 binding; corticotropin-releasing hormone receptor 2 binding; hormone activity; neuropeptide hormone activity; protein binding; receptor binding