Recombinant Mouse Crh protein, His-KSI-tagged
Cat.No. : | Crh-7564M |
Product Overview : | Recombinant Mouse Crh protein(Q8CIT0)(145-185aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 145-185a.a. |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Gene Name | Crh corticotropin releasing hormone [ Mus musculus ] |
Official Symbol | Crh |
Synonyms | CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; corticotropin-releasing factor; corticotropin-releasing hormone; CRF; Gm1347; MGC151298; |
Gene ID | 12918 |
mRNA Refseq | NM_205769 |
Protein Refseq | NP_991338 |
◆ Recombinant Proteins | ||
CRH-841H | Recombinant Human CRH Protein, His&GST-tagged | +Inquiry |
CRH-1596R | Recombinant Rat CRH Protein | +Inquiry |
CRH-3901M | Recombinant Mouse CRH Protein | +Inquiry |
Crh-7794R | Recombinant Rat Crh protein, His & GST-tagged | +Inquiry |
CRH-0033B | Recombinant Bacillus subtilis CRH protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CRH-107H | Recombinant Full Length Human CRH Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRH-7281HCL | Recombinant Human CRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Crh Products
Required fields are marked with *
My Review for All Crh Products
Required fields are marked with *
0
Inquiry Basket