Recombinant Mouse Crh protein, His-KSI-tagged

• Cat.No.: Crh-7564M
• Product Overview: Recombinant Mouse Crh protein(Q8CIT0)(145-185aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&KSI
• Protein Length: 145-185a.a.
• Tag: His-KSI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.1 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

Gene Information

• Gene Name: Crh corticotropin releasing hormone [ Mus musculus ]
• Official Symbol: Crh
• Synonyms: CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; corticotropin-releasing factor; corticotropin-releasing hormone; CRF; Gm1347; MGC151298
• Gene ID: 12918
• mRNA Refseq: NM_205769
• Protein Refseq: NP_991338