Recombinant Human CRIP1 Protein, His-tagged

• Cat.No.: CRIP1-290H
• Product Overview: Recombinant Human CRIP1 Protein(P50238)(1-77 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-77 aa
• Form: Phosphate buffered saline
• Molecular Mass: 9 kDa
• AASequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ]
• Official Symbol: CRIP1
• Synonyms: CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971
• Gene ID: 1396
• mRNA Refseq: NM_001311
• Protein Refseq: NP_001302
• MIM: 123875
• UniProt ID: P50238