Recombinant Human CRIP3 Protein, GST-tagged

Cat.No. : CRIP3-1878H
Product Overview : Human CRIP3 full-length ORF ( AAI48847.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CRIP3 (Cysteine Rich Protein 3) is a Protein Coding gene. An important paralog of this gene is CRIP2.
Molecular Mass : 49.39 kDa
AA Sequence : MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGVNIGDVGCYIYDPVKIKFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRIP3 cysteine-rich protein 3 [ Homo sapiens ]
Official Symbol CRIP3
Synonyms CRIP3; cysteine-rich protein 3; bA480N24.2; TLP; TLP A; CRP-3; h6LIMo; thymus LIM protein TLP-A; chromosome 6 LIM domain only protein; TLP-A;
Gene ID 401262
mRNA Refseq NM_206922
Protein Refseq NP_996805
UniProt ID Q6Q6R5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIP3 Products

Required fields are marked with *

My Review for All CRIP3 Products

Required fields are marked with *

0
cart-icon