Recombinant Human CRP Protein, GST-tagged

Cat.No. : CRP-1904H
Product Overview : Human CRP full-length ORF ( ENSP00000357093, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]
Molecular Mass : 36.8 kDa
AA Sequence : MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRP C-reactive protein, pentraxin-related [ Homo sapiens ]
Official Symbol CRP
Synonyms CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895;
Gene ID 1401
mRNA Refseq NM_000567
Protein Refseq NP_000558
MIM 123260
UniProt ID P02741

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRP Products

Required fields are marked with *

My Review for All CRP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon