Recombinant Human CRP Protein, GST-tagged
| Cat.No. : | CRP-1904H |
| Product Overview : | Human CRP full-length ORF ( ENSP00000357093, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009] |
| Molecular Mass : | 36.8 kDa |
| AA Sequence : | MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRP C-reactive protein, pentraxin-related [ Homo sapiens ] |
| Official Symbol | CRP |
| Synonyms | CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895; |
| Gene ID | 1401 |
| mRNA Refseq | NM_000567 |
| Protein Refseq | NP_000558 |
| MIM | 123260 |
| UniProt ID | P02741 |
| ◆ Recombinant Proteins | ||
| CRP-008D | Recombinant Dog C reactive Protein, His tagged | +Inquiry |
| CRP-3391C | Recombinant Chicken CRP | +Inquiry |
| Crp-849M | Recombinant Mouse Crp Protein, His-tagged | +Inquiry |
| Crp-7773G | Recombinant Guinea pig Crp protein, His & S-tagged | +Inquiry |
| CRP-0002H | Recombinant Human CRP Protein | +Inquiry |
| ◆ Native Proteins | ||
| CRP-4303H | Native Human C-reactive Protein | +Inquiry |
| CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
| CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
| CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
| CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
| CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
| CRP-1165HCL | Recombinant Human CRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRP Products
Required fields are marked with *
My Review for All CRP Products
Required fields are marked with *



