Recombinant Human CRP Protein, GST-tagged
Cat.No. : | CRP-1904H |
Product Overview : | Human CRP full-length ORF ( ENSP00000357093, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRP C-reactive protein, pentraxin-related [ Homo sapiens ] |
Official Symbol | CRP |
Synonyms | CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895; |
Gene ID | 1401 |
mRNA Refseq | NM_000567 |
Protein Refseq | NP_000558 |
MIM | 123260 |
UniProt ID | P02741 |
◆ Recombinant Proteins | ||
CRP-4437Z | Recombinant Zebrafish CRP | +Inquiry |
Crp-2319M | Recombinant Mouse Crp Protein, Myc/DDK-tagged | +Inquiry |
CRP-1488C | Recombinant Cynomolgus CRP protein, His-tagged | +Inquiry |
Crp-3291M | Recombinant Mouse Crp protein(Met1-Ser225), His-tagged | +Inquiry |
CRP-008H | Recombinant Human CRP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
CRP-1165HCL | Recombinant Human CRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRP Products
Required fields are marked with *
My Review for All CRP Products
Required fields are marked with *