"CRTC3" Related Products

Recombinant Human CRTC3 protein, GST-tagged

Cat.No.: CRTC3-32H
Product Overview: Recombinant Human CRTC3(176 a.a. - 274 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGN AFPHNGQNLGLSPFLGTLNTGGSL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CRTC3 CREB regulated transcription coactivator 3 [ Homo sapiens ]
Official Symbol: CRTC3
Synonyms: CRTC3; CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; FLJ21868; TORC-3; transducer of CREB protein 3; transducer of regulated CREB protein 3; transducer of regulated cAMP response element-binding protein 3; transducer of regulated cAMP response element-binding protein (CREB) 3; TORC3;
Gene ID: 64784
mRNA Refseq: NM_022769
Protein Refseq: NP_073606
MIM: 608986
UniProt ID: Q6UUV7
Chromosome Location: 15q26.1
Pathway: HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: cAMP response element binding protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.