Recombinant Human CRTC3 protein, GST-tagged
Cat.No. : | CRTC3-32H |
Product Overview : | Recombinant Human CRTC3(176 a.a. - 274 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 176-274 a.a. |
Description : | This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGN AFPHNGQNLGLSPFLGTLNTGGSL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CRTC3 CREB regulated transcription coactivator 3 [ Homo sapiens ] |
Official Symbol | CRTC3 |
Synonyms | CRTC3; CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; FLJ21868; TORC-3; transducer of CREB protein 3; transducer of regulated CREB protein 3; transducer of regulated cAMP response element-binding protein 3; transducer of regulated cAMP response element-binding protein (CREB) 3; TORC3; |
Gene ID | 64784 |
mRNA Refseq | NM_022769 |
Protein Refseq | NP_073606 |
MIM | 608986 |
UniProt ID | Q6UUV7 |
Chromosome Location | 15q26.1 |
Pathway | HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | cAMP response element binding protein binding; |
◆ Recombinant Proteins | ||
CRTC3-3928M | Recombinant Mouse CRTC3 Protein | +Inquiry |
CRTC3-1992M | Recombinant Mouse CRTC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRTC3-2207H | Recombinant Human CRTC3 Protein (Met1-Phe103), N-GST tagged | +Inquiry |
CRTC3-32H | Recombinant Human CRTC3 protein, GST-tagged | +Inquiry |
CRTC3-1114H | Recombinant Human CRTC3 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTC3 Products
Required fields are marked with *
My Review for All CRTC3 Products
Required fields are marked with *
0
Inquiry Basket