Recombinant Human CRTC3 protein, GST-tagged

Cat.No. : CRTC3-32H
Product Overview : Recombinant Human CRTC3(176 a.a. - 274 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 176-274 a.a.
Description : This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGN AFPHNGQNLGLSPFLGTLNTGGSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CRTC3 CREB regulated transcription coactivator 3 [ Homo sapiens ]
Official Symbol CRTC3
Synonyms CRTC3; CREB regulated transcription coactivator 3; CREB-regulated transcription coactivator 3; FLJ21868; TORC-3; transducer of CREB protein 3; transducer of regulated CREB protein 3; transducer of regulated cAMP response element-binding protein 3; transducer of regulated cAMP response element-binding protein (CREB) 3; TORC3;
Gene ID 64784
mRNA Refseq NM_022769
Protein Refseq NP_073606
MIM 608986
UniProt ID Q6UUV7
Chromosome Location 15q26.1
Pathway HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function cAMP response element binding protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRTC3 Products

Required fields are marked with *

My Review for All CRTC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon