Recombinant Human CRX

Cat.No. : CRX-26343TH
Product Overview : Recombinant fragment of Human CORD2 with a N terminal proprietary tag; Predicted MWt 36.08 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 95 amino acids
Description : The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Molecular Weight : 36.080kDa inclusive of tags
Tissue specificity : Retina.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Sequence Similarities : Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name CRX cone-rod homeobox [ Homo sapiens ]
Official Symbol CRX
Synonyms CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3;
Gene ID 1406
mRNA Refseq NM_000554
Protein Refseq NP_000545
MIM 602225
Uniprot ID O43186
Chromosome Location 19q13.3
Function chromatin binding; leucine zipper domain binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRX Products

Required fields are marked with *

My Review for All CRX Products

Required fields are marked with *

0
cart-icon
0
compare icon