Recombinant Human CRY1 protein, His&Myc-tagged
Cat.No. : | CRY1-4422H |
Product Overview : | Recombinant Human CRY1 protein(Q16526)(1-586aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-586aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73.8 kDa |
AA Sequence : | MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRY1 cryptochrome 1 (photolyase-like) [ Homo sapiens ] |
Official Symbol | CRY1 |
Synonyms | CRY1; cryptochrome 1 (photolyase-like); PHLL1; cryptochrome-1; photolyase-like cryptochrome 1; |
Gene ID | 1407 |
mRNA Refseq | NM_004075 |
Protein Refseq | NP_004066 |
MIM | 601933 |
UniProt ID | Q16526 |
◆ Recombinant Proteins | ||
CRY1-1922H | Recombinant Human CRY1 Protein, GST-tagged | +Inquiry |
CRY1-1266R | Recombinant Rat CRY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRY1-861R | Recombinant Rhesus Macaque CRY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRY1-1993M | Recombinant Mouse CRY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRY1-5818C | Recombinant Chicken CRY1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY1-7269HCL | Recombinant Human CRY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY1 Products
Required fields are marked with *
My Review for All CRY1 Products
Required fields are marked with *
0
Inquiry Basket