Recombinant Human CRY2 Protein, GST-tagged
Cat.No. : | CRY2-1923H |
Product Overview : | Human CRY2 full-length ORF ( NP_066940.1, 1 a.a. - 593 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014] |
Molecular Mass : | 93.3 kDa |
AA Sequence : | MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRY2 cryptochrome 2 (photolyase-like) [ Homo sapiens ] |
Official Symbol | CRY2 |
Synonyms | CRY2; cryptochrome 2 (photolyase-like); cryptochrome-2; growth-inhibiting protein 37; HCRY2; PHLL2; FLJ10332; KIAA0658; |
Gene ID | 1408 |
mRNA Refseq | NM_001127457 |
Protein Refseq | NP_001120929 |
MIM | 603732 |
UniProt ID | Q49AN0 |
◆ Recombinant Proteins | ||
CRY2-5566A | Recombinant Mouse-ear cress CRY2 Protein (Met1-Lys612), N-His tagged | +Inquiry |
CRY2-26941TH | Recombinant Human CRY2 | +Inquiry |
CRY2-647H | Recombinant Human CRY2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRY2-11597H | Recombinant Human CRY2, His-tagged | +Inquiry |
CRY2-1923H | Recombinant Human CRY2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY2-7268HCL | Recombinant Human CRY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRY2 Products
Required fields are marked with *
My Review for All CRY2 Products
Required fields are marked with *
0
Inquiry Basket