Recombinant Human CRYBA2 Protein, GST-tagged
| Cat.No. : | CRYBA2-1929H |
| Product Overview : | Human CRYBA2 full-length ORF ( AAH06285, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRYBA2 crystallin, beta A2 [ Homo sapiens ] |
| Official Symbol | CRYBA2 |
| Synonyms | CRYBA2; crystallin, beta A2; beta-crystallin A2; eye lens structural protein; |
| Gene ID | 1412 |
| mRNA Refseq | NM_005209 |
| Protein Refseq | NP_005200 |
| MIM | 600836 |
| UniProt ID | P53672 |
| ◆ Recombinant Proteins | ||
| CRYBA2-6666H | Recombinant Human CRYBA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CRYBA2-1039R | Recombinant Rhesus monkey CRYBA2 Protein, His-tagged | +Inquiry |
| CRYBA2-3734H | Recombinant Human CRYBA2 protein, His-tagged | +Inquiry |
| CRYBA2-5753C | Recombinant Chicken CRYBA2 | +Inquiry |
| CRYBA2-2130HF | Recombinant Full Length Human CRYBA2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYBA2-7264HCL | Recombinant Human CRYBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYBA2 Products
Required fields are marked with *
My Review for All CRYBA2 Products
Required fields are marked with *
