Recombinant Human CRYBA4 protein, GST-tagged

• Cat.No.: CRYBA4-301499H
• Product Overview: Recombinant Human CRYBA4 (1-44 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Val44
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CRYBA4 crystallin, beta A4 [ Homo sapiens ]
• Official Symbol: CRYBA4
• Synonyms: CRYBA4; crystallin, beta A4; beta-crystallin A4; beta-A4 crystallin; eye lens structural protein; crystallin, beta polypeptide A4; MCOPCT4
• Gene ID: 1413
• mRNA Refseq: NM_001886
• Protein Refseq: NP_001877
• MIM: 123631
• UniProt ID: P53673