Recombinant Human CRYBA4 protein, GST-tagged
Cat.No. : | CRYBA4-301499H |
Product Overview : | Recombinant Human CRYBA4 (1-44 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val44 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CRYBA4 crystallin, beta A4 [ Homo sapiens ] |
Official Symbol | CRYBA4 |
Synonyms | CRYBA4; crystallin, beta A4; beta-crystallin A4; beta-A4 crystallin; eye lens structural protein; crystallin, beta polypeptide A4; MCOPCT4; |
Gene ID | 1413 |
mRNA Refseq | NM_001886 |
Protein Refseq | NP_001877 |
MIM | 123631 |
UniProt ID | P53673 |
◆ Recombinant Proteins | ||
CRYBA4-1270R | Recombinant Rat CRYBA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYBA4-1612R | Recombinant Rat CRYBA4 Protein | +Inquiry |
CRYBA4-2131HF | Recombinant Full Length Human CRYBA4 Protein, GST-tagged | +Inquiry |
CRYBA4-301499H | Recombinant Human CRYBA4 protein, GST-tagged | +Inquiry |
CRYBA4-4987H | Recombinant Human Crystallin, Beta A4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYBA4-7263HCL | Recombinant Human CRYBA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYBA4 Products
Required fields are marked with *
My Review for All CRYBA4 Products
Required fields are marked with *