Recombinant Human CRYGC
Cat.No. : | CRYGC-27305TH |
Product Overview : | Recombinant fragment of Human gamma C Crystallin with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY |
Sequence Similarities : | Belongs to the beta/gamma-crystallin family.Contains 4 beta/gamma crystallin Greek key domains. |
Gene Name | CRYGC crystallin, gamma C [ Homo sapiens ] |
Official Symbol | CRYGC |
Synonyms | CRYGC; crystallin, gamma C; CRYG3; gamma-crystallin C; |
Gene ID | 1420 |
mRNA Refseq | NM_020989 |
Protein Refseq | NP_066269 |
Uniprot ID | P07315 |
Chromosome Location | 2q33-q35 |
Function | protein binding; structural constituent of eye lens; |
◆ Recombinant Proteins | ||
CRYGC-4477H | Recombinant Human CRYGC protein, His-tagged | +Inquiry |
CRYGC-1276R | Recombinant Rat CRYGC Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGC-2971H | Recombinant Human CRYGC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRYGC-11605H | Recombinant Human CRYGC, His-tagged | +Inquiry |
CRYGC-869R | Recombinant Rhesus Macaque CRYGC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGC-7258HCL | Recombinant Human CRYGC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGC Products
Required fields are marked with *
My Review for All CRYGC Products
Required fields are marked with *