Recombinant Human CRYGS protein, GST-tagged
Cat.No. : | CRYGS-2737H |
Product Overview : | Recombinant Human CRYGS protein(P22914)(2-178aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-178aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRYGS crystallin, gamma S [ Homo sapiens ] |
Official Symbol | CRYGS |
Synonyms | CRYGS; crystallin, gamma S; CRYG8; beta-crystallin S; crystallin; gamma 8; gamma-S-crystallin; gamma-crystallin S; crystallin, gamma 8; |
Gene ID | 1427 |
mRNA Refseq | NM_017541 |
Protein Refseq | NP_060011 |
UniProt ID | P22914 |
◆ Recombinant Proteins | ||
Crygs-2333M | Recombinant Mouse Crygs Protein, Myc/DDK-tagged | +Inquiry |
CRYGS-4047C | Recombinant Chicken CRYGS | +Inquiry |
CRYGS-2737H | Recombinant Human CRYGS protein, GST-tagged | +Inquiry |
CRYGS-1621R | Recombinant Rat CRYGS Protein | +Inquiry |
CRYGS-11607H | Recombinant Human CRYGS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGS-7255HCL | Recombinant Human CRYGS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGS Products
Required fields are marked with *
My Review for All CRYGS Products
Required fields are marked with *