Recombinant Human CRYZ protein, GST-tagged
| Cat.No. : | CRYZ-6743H | 
| Product Overview : | Recombinant Human CRYZ protein(143-329 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 143-329 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | SACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL | 
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | CRYZ crystallin, zeta (quinone reductase) [ Homo sapiens ] | 
| Official Symbol | CRYZ | 
| Synonyms | CRYZ; crystallin, zeta (quinone reductase); quinone oxidoreductase; NADPH:quinone reductase; FLJ41475; DKFZp779E0834; | 
| Gene ID | 1429 | 
| mRNA Refseq | NM_001130042 | 
| Protein Refseq | NP_001123514 | 
| MIM | 123691 | 
| UniProt ID | Q08257 | 
| ◆ Recombinant Proteins | ||
| CRYZ-3595C | Recombinant Chicken CRYZ | +Inquiry | 
| CRYZ-1947H | Recombinant Human CRYZ Protein, GST-tagged | +Inquiry | 
| CRYZ-2145HF | Recombinant Full Length Human CRYZ Protein, GST-tagged | +Inquiry | 
| CRYZ-257H | Recombinant Human CRYZ, His-tagged | +Inquiry | 
| CRYZ-3952M | Recombinant Mouse CRYZ Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CRYZ-408HCL | Recombinant Human CRYZ cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYZ Products
Required fields are marked with *
My Review for All CRYZ Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            