Recombinant Human CS Protein, GST-tagged
Cat.No. : | CS-1950H |
Product Overview : | Human CS full-length ORF ( AAH00105.3, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 54.67 kDa |
AA Sequence : | MDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CS citrate synthase [ Homo sapiens ] |
Official Symbol | CS |
Synonyms | CS; citrate synthase; citrate synthase, mitochondrial; |
Gene ID | 1431 |
mRNA Refseq | NM_004077 |
Protein Refseq | NP_004068 |
MIM | 118950 |
UniProt ID | O75390 |
◆ Recombinant Proteins | ||
Cs-1774M | Recombinant Mouse Cs protein, His & T7-tagged | +Inquiry |
CS-10001Z | Recombinant Zebrafish CS | +Inquiry |
CS-1625R | Recombinant Rat CS Protein | +Inquiry |
CS-172C | Recombinant Cynomolgus Monkey CS Protein, His (Fc)-Avi-tagged | +Inquiry |
CS-11610H | Recombinant Human CS, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Cs-164P | Active Native Porcine Citrate Synthase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CS-001HCL | Recombinant Human CS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CS Products
Required fields are marked with *
My Review for All CS Products
Required fields are marked with *