Recombinant Human CSAD protein, His-tagged
| Cat.No. : | CSAD-3538H |
| Product Overview : | Recombinant Human CSAD protein(344-493 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 344-493 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CSAD cysteine sulfinic acid decarboxylase [ Homo sapiens ] |
| Official Symbol | CSAD |
| Synonyms | CSAD; cysteine sulfinic acid decarboxylase; CSD; P selectin cytoplasmic tail associated protein; PCAP; sulfinoalanine decarboxylase; cysteine-sulfinate decarboxylase; P-selectin cytoplasmic tail-associated protein; cysteine sulfinic acid decarboxylase-related protein; FLJ44987; FLJ45500; MGC119354; MGC119355; MGC119357; |
| Gene ID | 51380 |
| mRNA Refseq | NM_001244705 |
| Protein Refseq | NP_001231634 |
| UniProt ID | Q9Y600 |
| ◆ Recombinant Proteins | ||
| CSAD-2148HF | Recombinant Full Length Human CSAD Protein, GST-tagged | +Inquiry |
| CSAD-1953H | Recombinant Human CSAD Protein, GST-tagged | +Inquiry |
| CSAD-428M | Recombinant Mouse CSAD Protein (1-493 aa), His-SUMO-tagged | +Inquiry |
| CSAD-3538H | Recombinant Human CSAD protein, His-tagged | +Inquiry |
| CSAD-2009M | Recombinant Mouse CSAD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSAD Products
Required fields are marked with *
My Review for All CSAD Products
Required fields are marked with *
