Recombinant Human CSDA protein, His-tagged
Cat.No. : | CSDA-3237H |
Product Overview : | Recombinant Human CSDA protein(78-175 aa), fused to His tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 78-175 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CSDA cold shock domain protein A [ Homo sapiens ] |
Official Symbol | CSDA |
Synonyms | CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA; |
Gene ID | 8531 |
mRNA Refseq | NM_001145426 |
Protein Refseq | NP_001138898 |
MIM | 603437 |
UniProt ID | P16989 |
◆ Recombinant Proteins | ||
CSDA-3237H | Recombinant Human CSDA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSDA-409HCL | Recombinant Human CSDA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSDA Products
Required fields are marked with *
My Review for All CSDA Products
Required fields are marked with *