Recombinant Human CSDA protein, His-tagged

• Cat.No.: CSDA-3237H
• Product Overview: Recombinant Human CSDA protein(78-175 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 78-175 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: GSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CSDA cold shock domain protein A [ Homo sapiens ]
• Official Symbol: CSDA
• Synonyms: CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA
• Gene ID: 8531
• mRNA Refseq: NM_001145426
• Protein Refseq: NP_001138898
• MIM: 603437
• UniProt ID: P16989