Recombinant Human CSF2 Protein, GST-tagged

Cat.No. : CSF2-1969H
Product Overview : Human CSF2 full-length ORF ( AAI14000.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]
Molecular Mass : 42.7 kDa
AA Sequence : MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ]
Official Symbol CSF2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897;
Gene ID 1437
mRNA Refseq NM_000758
Protein Refseq NP_000749
MIM 138960
UniProt ID P04141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon