Recombinant Human CSF2RA protein, His-SUMO-tagged
| Cat.No. : | CSF2RA-2741H |
| Product Overview : | Recombinant Human CSF2RA protein(P15509)(23-320aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-320aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.5 kDa |
| AA Sequence : | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ] |
| Official Symbol | CSF2RA |
| Synonyms | CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha; |
| Gene ID | 1438 |
| mRNA Refseq | NM_001161529 |
| Protein Refseq | NP_001155001 |
| MIM | 306250 |
| UniProt ID | P15509 |
| ◆ Recombinant Proteins | ||
| CSF2RA-34H | Active Recombinant Human CSF2RA Homodimer Protein, His&Avi tagged | +Inquiry |
| CSF2RA-5499H | Recombinant Human CSF2RA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CSF2RA-3775H | Recombinant Human CSF2RA protein, rFc-tagged | +Inquiry |
| CSF2RA-509H | Recombinant Human CSF2RA protein, His-Avi-tagged | +Inquiry |
| CSF2RA-1970H | Recombinant Human CSF2RA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSF2RA-2713HCL | Recombinant Human CSF2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2RA Products
Required fields are marked with *
My Review for All CSF2RA Products
Required fields are marked with *



