Active Recombinant Mouse Csf3 Protein

Cat.No. : Csf3-280C
Product Overview : Recombinant Mouse Csf3 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Description : Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.02 ng/mL, measured in a cell proliferation assay using NFS-60 cells.
Molecular Mass : 22-24 kDa, observed by reducing SDS-PAGE.
AA Sequence : VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus ]
Official Symbol Csf3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG;
Gene ID 12985
mRNA Refseq NM_009971
Protein Refseq NP_034101
UniProt ID P09920

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon
0
compare icon