Recombinant Human CSGALNACT1 protein, GST-tagged

• Cat.No.: CSGALNACT1-3716H
• Product Overview: Recombinant Human CSGALNACT1 (89-149 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 89-149 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CSGALNACT1 chondroitin sulfate N-acetylgalactosaminyltransferase 1 [ Homo sapiens ]
• Official Symbol: CSGALNACT1
• Synonyms: CSGALNACT1; chondroitin sulfate N-acetylgalactosaminyltransferase 1; ChGn; chondroitin beta1; 4 N acetylgalactosaminyltransferase; CSGalNAcT 1; FLJ11264; beta4GalNAcT-1; chondroitin beta1,4 N-acetylgalactosaminyltransferase; chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1; CSGalNAcT-1; beta4GalNAcT; FLJ13760
• Gene ID: 55790
• mRNA Refseq: NM_001130518
• Protein Refseq: NP_001123990
• UniProt ID: Q8TDX6