Recombinant Human CSGALNACT1 protein, GST-tagged

Cat.No. : CSGALNACT1-3716H
Product Overview : Recombinant Human CSGALNACT1 (89-149 aa), fused to GST tag, was expressed in E. coli.
Availability August 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 89-149 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CSGALNACT1 chondroitin sulfate N-acetylgalactosaminyltransferase 1 [ Homo sapiens ]
Official Symbol CSGALNACT1
Synonyms CSGALNACT1; chondroitin sulfate N-acetylgalactosaminyltransferase 1; ChGn; chondroitin beta1; 4 N acetylgalactosaminyltransferase; CSGalNAcT 1; FLJ11264; beta4GalNAcT-1; chondroitin beta1,4 N-acetylgalactosaminyltransferase; chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1; CSGalNAcT-1; beta4GalNAcT; FLJ13760;
Gene ID 55790
mRNA Refseq NM_001130518
Protein Refseq NP_001123990
UniProt ID Q8TDX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSGALNACT1 Products

Required fields are marked with *

My Review for All CSGALNACT1 Products

Required fields are marked with *

0
cart-icon