Recombinant Human CSH2 protein, His-GST-tagged
Cat.No. : | CSH2-058H |
Product Overview : | Recombinant Human CSH2 protein(27-217aa)(P0DML3), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 27-217aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CSH2 chorionic somatomammotropin hormone 2 [ Homo sapiens ] |
Official Symbol | CSH2 |
Synonyms | CSB; CS-2; hCS-B |
Gene ID | 1443 |
mRNA Refseq | NM_022645.2 |
Protein Refseq | NP_072171.1 |
MIM | 118820 |
UniProt ID | P01243 |
◆ Recombinant Proteins | ||
CSH2-1054R | Recombinant Rhesus monkey CSH2 Protein, His-tagged | +Inquiry |
CSH2-058H | Recombinant Human CSH2 protein, His-GST-tagged | +Inquiry |
CSH2-879R | Recombinant Rhesus Macaque CSH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSH2-2178HF | Recombinant Full Length Human CSH2 Protein, GST-tagged | +Inquiry |
CSH2-1978H | Recombinant Human CSH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSH2-7247HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSH2 Products
Required fields are marked with *
My Review for All CSH2 Products
Required fields are marked with *
0
Inquiry Basket