Recombinant Human CSH2 protein, His-GST-tagged

Cat.No. : CSH2-058H
Product Overview : Recombinant Human CSH2 protein(27-217aa)(P0DML3), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 27-217aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.8 kDa
AA Sequence : VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CSH2 chorionic somatomammotropin hormone 2 [ Homo sapiens ]
Official Symbol CSH2
Synonyms CSB; CS-2; hCS-B
Gene ID 1443
mRNA Refseq NM_022645.2
Protein Refseq NP_072171.1
MIM 118820
UniProt ID P01243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSH2 Products

Required fields are marked with *

My Review for All CSH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon