Recombinant Human CSH2 Protein, GST-tagged
Cat.No. : | CSH2-1978H |
Product Overview : | Human CSH2 full-length ORF ( NP_066271.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSH2 chorionic somatomammotropin hormone 2 [ Homo sapiens ] |
Official Symbol | CSH2 |
Synonyms | CSB; CS-2; hCS-B |
Gene ID | 1443 |
mRNA Refseq | NM_022645.2 |
Protein Refseq | NP_072171.1 |
MIM | 118820 |
UniProt ID | P01243 |
◆ Recombinant Proteins | ||
CSH2-879R | Recombinant Rhesus Macaque CSH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSH2-7660B | Recombinant Bovine CSH2 | +Inquiry |
CSH2-2178HF | Recombinant Full Length Human CSH2 Protein, GST-tagged | +Inquiry |
CSH2-058H | Recombinant Human CSH2 protein, His-GST-tagged | +Inquiry |
CSH2-1978H | Recombinant Human CSH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSH2-7247HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSH2 Products
Required fields are marked with *
My Review for All CSH2 Products
Required fields are marked with *
0
Inquiry Basket