Recombinant Human CSMD3 Protein, GST-tagged

• Cat.No.: CSMD3-1981H
• Product Overview: Human CSMD3 partial ORF ( NP_937757.1, 3615 a.a. - 3667 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CSMD3 (CUB And Sushi Multiple Domains 3) is a Protein Coding gene. Diseases associated with CSMD3 include Benign Adult Familial Myoclonic Epilepsy and Trichorhinophalangeal Syndrome, Type Ii. An important paralog of this gene is CSMD1.
• Molecular Mass: 31.57 kDa
• AA Sequence: RTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSMD3 CUB and Sushi multiple domains 3 [ Homo sapiens ]
• Official Symbol: CSMD3
• Synonyms: CSMD3; CUB and Sushi multiple domains 3; CUB And Sushi Multiple Domains 3; CUB And Sushi Multiple Domains Protein 3; KIAA1894
• Gene ID: 114788
• mRNA Refseq: NM_198124.1
• Protein Refseq: NP_937757.1
• MIM: 608399
• UniProt ID: Q7Z407