Recombinant Human CSMD3 Protein, GST-tagged

Cat.No. : CSMD3-1981H
Product Overview : Human CSMD3 partial ORF ( NP_937757.1, 3615 a.a. - 3667 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CSMD3 (CUB And Sushi Multiple Domains 3) is a Protein Coding gene. Diseases associated with CSMD3 include Benign Adult Familial Myoclonic Epilepsy and Trichorhinophalangeal Syndrome, Type Ii. An important paralog of this gene is CSMD1.
Molecular Mass : 31.57 kDa
AA Sequence : RTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSMD3 CUB and Sushi multiple domains 3 [ Homo sapiens ]
Official Symbol CSMD3
Synonyms CSMD3; CUB and Sushi multiple domains 3; CUB And Sushi Multiple Domains 3; CUB And Sushi Multiple Domains Protein 3; KIAA1894
Gene ID 114788
mRNA Refseq NM_198124.1
Protein Refseq NP_937757.1
MIM 608399
UniProt ID Q7Z407

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSMD3 Products

Required fields are marked with *

My Review for All CSMD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon