Recombinant Human CSMD3 Protein, GST-tagged
Cat.No. : | CSMD3-1981H |
Product Overview : | Human CSMD3 partial ORF ( NP_937757.1, 3615 a.a. - 3667 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CSMD3 (CUB And Sushi Multiple Domains 3) is a Protein Coding gene. Diseases associated with CSMD3 include Benign Adult Familial Myoclonic Epilepsy and Trichorhinophalangeal Syndrome, Type Ii. An important paralog of this gene is CSMD1. |
Molecular Mass : | 31.57 kDa |
AA Sequence : | RTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSMD3 CUB and Sushi multiple domains 3 [ Homo sapiens ] |
Official Symbol | CSMD3 |
Synonyms | CSMD3; CUB and Sushi multiple domains 3; CUB And Sushi Multiple Domains 3; CUB And Sushi Multiple Domains Protein 3; KIAA1894 |
Gene ID | 114788 |
mRNA Refseq | NM_198124.1 |
Protein Refseq | NP_937757.1 |
MIM | 608399 |
UniProt ID | Q7Z407 |
◆ Recombinant Proteins | ||
CSMD3-3969M | Recombinant Mouse CSMD3 Protein | +Inquiry |
CSMD3-1981H | Recombinant Human CSMD3 Protein, GST-tagged | +Inquiry |
CSMD3-2017M | Recombinant Mouse CSMD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSMD3 Products
Required fields are marked with *
My Review for All CSMD3 Products
Required fields are marked with *
0
Inquiry Basket