Recombinant Human CSNK1E, His-tagged
Cat.No. : | CSNK1E-27871TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 168-416 of Human CK1 epsilon with N terminal His tag. MWt ~31 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 168-416 a.a. |
Description : | The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed in all tissues examined, including brain, heart, lung, liver, pancreas, kidney, placenta and skeletal muscle. Expressed in monocytes and lymphocytes but not in granulocytes. |
Form : | Lyophilised:Reconstitution with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | (Amino acid sequence (Sequence determined by 5 Sequencing))RENKNLTGTARYASINTHLGIEQSRRDD LESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKM STPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLF RNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREH EREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVA STPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVS SSDLTGRQEVSRIPASQTSVPFDHLGK |
Sequence Similarities : | Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.Contains 1 protein kinase domain. |
Gene Name | CSNK1E casein kinase 1, epsilon [ Homo sapiens ] |
Official Symbol | CSNK1E |
Synonyms | CSNK1E; casein kinase 1, epsilon; casein kinase I isoform epsilon; HCKIE; |
Gene ID | 1454 |
mRNA Refseq | NM_001894 |
Protein Refseq | NP_001885 |
MIM | 600863 |
Uniprot ID | P49674 |
Chromosome Location | 22q13.1 |
Pathway | Canonical Wnt signaling pathway, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Circadian Clock, organism-specific biosystem; Circadian rhythm - mammal, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
CSNK1E-1370H | Recombinant Human CSNK1E Protein (1-416 aa), His-tagged | +Inquiry |
CSNK1E-1183H | Recombinant Human CSNK1E Protein (17-231 aa), GST-tagged | +Inquiry |
CSNK1E-1007H | Recombinant Human Casein Kinase 1, Epsilon, GST-tagged | +Inquiry |
CSNK1E-0202H | Recombinant Human CSNK1E Protein (E2-K416), Tag Free | +Inquiry |
CSNK1E-764HFL | Recombinant Full Length Human CSNK1E Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1E-7240HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
CSNK1E-7239HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK1E Products
Required fields are marked with *
My Review for All CSNK1E Products
Required fields are marked with *