Recombinant Human CSNK1G2 Protein, His-tagged
| Cat.No. : | CSNK1G2-850H |
| Product Overview : | Recombinant Human CSNK1G2 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 500mM NaCl, 10% Glycerol, 1mM DTT, pH 8.0 |
| Molecular Mass : | 47.6kD |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPW |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | CSNK1G2 casein kinase 1, gamma 2 [ Homo sapiens ] |
| Official Symbol | CSNK1G2 |
| Synonyms | CSNK1G2; casein kinase 1, gamma 2; casein kinase I isoform gamma-2; CK1g2; CKI-gamma 2; casein kinase 1 isoform gamma-2; |
| Gene ID | 1455 |
| mRNA Refseq | NM_001319 |
| Protein Refseq | NP_001310 |
| MIM | 602214 |
| UniProt ID | P78368 |
| ◆ Recombinant Proteins | ||
| CSNK1G2-850H | Recombinant Human CSNK1G2 Protein, His-tagged | +Inquiry |
| CSNK1G2-26811TH | Recombinant Human CSNK1G2 | +Inquiry |
| CSNK1G2-2021M | Recombinant Mouse CSNK1G2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CSNK1G2-1999H | Active Recombinant Human CSNK1G2 Protein, GST-tagged | +Inquiry |
| CSNK1G2-1190H | Recombinant Human CSNK1G2 Protein (K5-D353), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSNK1G2-597HCL | Recombinant Human CSNK1G2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK1G2 Products
Required fields are marked with *
My Review for All CSNK1G2 Products
Required fields are marked with *
