Recombinant Human CSNK1G2 Protein, His-tagged
Cat.No. : | CSNK1G2-850H |
Product Overview : | Recombinant Human CSNK1G2 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris, 500mM NaCl, 10% Glycerol, 1mM DTT, pH 8.0 |
Molecular Mass : | 47.6kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPW |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | CSNK1G2 casein kinase 1, gamma 2 [ Homo sapiens ] |
Official Symbol | CSNK1G2 |
Synonyms | CSNK1G2; casein kinase 1, gamma 2; casein kinase I isoform gamma-2; CK1g2; CKI-gamma 2; casein kinase 1 isoform gamma-2; |
Gene ID | 1455 |
mRNA Refseq | NM_001319 |
Protein Refseq | NP_001310 |
MIM | 602214 |
UniProt ID | P78368 |
◆ Recombinant Proteins | ||
CSNK1G2-2195HF | Recombinant Full Length Human CSNK1G2 Protein, GST-tagged | +Inquiry |
CSNK1G2-26811TH | Recombinant Human CSNK1G2 | +Inquiry |
CSNK1G2-1999H | Active Recombinant Human CSNK1G2 Protein, GST-tagged | +Inquiry |
CSNK1G2-1635R | Recombinant Rat CSNK1G2 Protein | +Inquiry |
CSNK1G2-2021M | Recombinant Mouse CSNK1G2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1G2-597HCL | Recombinant Human CSNK1G2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSNK1G2 Products
Required fields are marked with *
My Review for All CSNK1G2 Products
Required fields are marked with *
0
Inquiry Basket