Recombinant Human CSNK1G2 Protein, His-tagged

Cat.No. : CSNK1G2-850H
Product Overview : Recombinant Human CSNK1G2 fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris, 500mM NaCl, 10% Glycerol, 1mM DTT, pH 8.0
Molecular Mass : 47.6kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPW
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name CSNK1G2 casein kinase 1, gamma 2 [ Homo sapiens ]
Official Symbol CSNK1G2
Synonyms CSNK1G2; casein kinase 1, gamma 2; casein kinase I isoform gamma-2; CK1g2; CKI-gamma 2; casein kinase 1 isoform gamma-2;
Gene ID 1455
mRNA Refseq NM_001319
Protein Refseq NP_001310
MIM 602214
UniProt ID P78368

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSNK1G2 Products

Required fields are marked with *

My Review for All CSNK1G2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon