Recombinant Human CSNK2A2 Protein, Full Length, N-His tagged

• Cat.No.: CSNK2A2-13HFL
• Product Overview: Recombinant human CSNK2A2 protein (Full Length), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Full Length
• Description: Casein kinase 2 subunit alpha, also known as CSNK2A2, regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. This protein may act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response.
• Form: Liquid
• Molecular Mass: 43.7 kDa (374aa) confirmed by MALDI-TOF
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol, 1mM DTT
• References: 1. Keller D.M., et al. (2001) Mol. Cell. 7:283-292
  2. Sayed M., et al. (2001) Oncogene. 20:6994-7005

Gene Information

• Gene Name: CSNK2A2 casein kinase 2 alpha 2 [ Homo sapiens (human) ]
• Official Symbol: CSNK2A2
• Synonyms: CSNK2A2; casein kinase 2 alpha 2; CK2A2; CSNK2A1; CK2alpha'; casein kinase II subunit alpha'; CK II alpha'; casein kinase 2 alpha'; casein kinase 2, alpha prime polypeptide; EC 2.7.11.1
• Gene ID: 1459
• mRNA Refseq: NM_001896
• Protein Refseq: NP_001887
• MIM: 115442
• UniProt ID: P19784