Recombinant Human CSNK2A2 Protein, GST-tagged
Cat.No. : | CSNK2A2-2010H |
Product Overview : | Human CSNK2A2 full-length ORF ( AAH08812.1, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha', and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11. [provided by RefSeq, Aug 2017] |
Molecular Mass : | 64.13 kDa |
AA Sequence : | MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Applications : | Kinase Assay Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSNK2A2 casein kinase 2, alpha prime polypeptide [ Homo sapiens ] |
Official Symbol | CSNK2A2 |
Synonyms | CSNK2A2; casein kinase 2, alpha prime polypeptide; casein kinase II subunit alpha; CSNK2A1; CK II alpha; CK2A2; FLJ43934; |
Gene ID | 1459 |
mRNA Refseq | NM_001896 |
Protein Refseq | NP_001887 |
MIM | 115442 |
UniProt ID | P19784 |
◆ Recombinant Proteins | ||
CSNK2A2-169H | Active Recombinant Human CSNK2A2 | +Inquiry |
CSNK2A2-682H | Recombinant Human CSNK2A2, GST-tagged | +Inquiry |
Csnk2a2-2341M | Recombinant Mouse Csnk2a2 Protein, Myc/DDK-tagged | +Inquiry |
CSNK2A2-39HFL | Active Recombinant Full Length Human CSNK2A2 Protein, N-His-tagged | +Inquiry |
CSNK2A2-3980M | Recombinant Mouse CSNK2A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK2A2-001HCL | Recombinant Human CSNK2A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSNK2A2 Products
Required fields are marked with *
My Review for All CSNK2A2 Products
Required fields are marked with *