Recombinant Human CSPG5 Protein, GST-tagged

Cat.No. : CSPG5-2015H
Product Overview : Human CSPG5 partial ORF ( NP_006565, 445 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
Molecular Mass : 36.19 kDa
AA Sequence : KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSPG5 chondroitin sulfate proteoglycan 5 (neuroglycan C) [ Homo sapiens ]
Official Symbol CSPG5
Synonyms CSPG5; chondroitin sulfate proteoglycan 5 (neuroglycan C); chondroitin sulfate proteoglycan 5; NGC; acidic leucine-rich EGF-like domain-containing brain protein; MGC44034;
Gene ID 10675
mRNA Refseq NM_001206942
Protein Refseq NP_001193871
MIM 606775
UniProt ID O95196

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSPG5 Products

Required fields are marked with *

My Review for All CSPG5 Products

Required fields are marked with *

0
cart-icon
0
compare icon