Recombinant Human CSPG5 Protein, GST-tagged
Cat.No. : | CSPG5-2015H |
Product Overview : | Human CSPG5 partial ORF ( NP_006565, 445 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
Molecular Mass : | 36.19 kDa |
AA Sequence : | KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSPG5 chondroitin sulfate proteoglycan 5 (neuroglycan C) [ Homo sapiens ] |
Official Symbol | CSPG5 |
Synonyms | CSPG5; chondroitin sulfate proteoglycan 5 (neuroglycan C); chondroitin sulfate proteoglycan 5; NGC; acidic leucine-rich EGF-like domain-containing brain protein; MGC44034; |
Gene ID | 10675 |
mRNA Refseq | NM_001206942 |
Protein Refseq | NP_001193871 |
MIM | 606775 |
UniProt ID | O95196 |
◆ Recombinant Proteins | ||
CSPG5-3984M | Recombinant Mouse CSPG5 Protein | +Inquiry |
CSPG5-1298R | Recombinant Rat CSPG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSPG5-1640R | Recombinant Rat CSPG5 Protein | +Inquiry |
CSPG5-2025M | Recombinant Mouse CSPG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4090HF | Recombinant Full Length Human Chondroitin Sulfate Proteoglycan 5(Cspg5) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSPG5 Products
Required fields are marked with *
My Review for All CSPG5 Products
Required fields are marked with *