"CSPP1" Related Products

Recombinant Human CSPP1 protein, GST-tagged

Cat.No.: CSPP1-16H
Product Overview: Human CSPP1 full-length ORF ( AAH22867.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
Source: Wheat Germ (in vitro)
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 70 kDa
AA Sequence: MRQPSPIVPALQNKIASKLQRPPSVDSIIHSFIHESSMSRAQSPPVPARKNQLRAEEEKKNVIMELSEMRKQLRS EERRLQERLLHMDSDDEIPIRKKERNPMDIFDMARHRLQAPVRRQSPKGLDAATFQNVHDFNELKDRDSETRVDL KFMYLDPPRDHHTLEIQQQALLREQQKRLNRIKMQEGAKVDLDAIPSAKVREQRMPRDDTSDFLKNSLLESDSAF IGAYGETYPAIEDDVLPPPSQLPSARERRRNKRKGLDIDSSRPNVAPDGLSLKSISSVNVDELRVRNEERMRRLN EFHNKPINTDDESSLVDPDDIMKHIGDDGSNSVATEPWLRPGTSETLKRFMAEQLNQEQQQIPGKPGTFTWQGLS TAHG
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: CSPP1 centrosome and spindle pole associated protein 1 [ Homo sapiens ]
Official Symbol: CSPP1
Synonyms: CSPP1; centrosome and spindle pole associated protein 1; centrosome and spindle pole-associated protein 1; CSPP; FLJ22490; FLJ38886;
Gene ID: 79848
mRNA Refseq: NM_024790
Protein Refseq: NP_079066
MIM: 611654
UniProt ID: Q1MSJ5
Chromosome Location: 8q13.2
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.