Recombinant Human CSPP1 protein, GST-tagged
Cat.No. : | CSPP1-16H |
Product Overview : | Human CSPP1 full-length ORF ( AAH22867.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 70 kDa |
AA Sequence : | MRQPSPIVPALQNKIASKLQRPPSVDSIIHSFIHESSMSRAQSPPVPARKNQLRAEEEKKNVIMELSEMRKQLRS EERRLQERLLHMDSDDEIPIRKKERNPMDIFDMARHRLQAPVRRQSPKGLDAATFQNVHDFNELKDRDSETRVDL KFMYLDPPRDHHTLEIQQQALLREQQKRLNRIKMQEGAKVDLDAIPSAKVREQRMPRDDTSDFLKNSLLESDSAF IGAYGETYPAIEDDVLPPPSQLPSARERRRNKRKGLDIDSSRPNVAPDGLSLKSISSVNVDELRVRNEERMRRLN EFHNKPINTDDESSLVDPDDIMKHIGDDGSNSVATEPWLRPGTSETLKRFMAEQLNQEQQQIPGKPGTFTWQGLS TAHG |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CSPP1 centrosome and spindle pole associated protein 1 [ Homo sapiens ] |
Official Symbol | CSPP1 |
Synonyms | CSPP1; centrosome and spindle pole associated protein 1; centrosome and spindle pole-associated protein 1; CSPP; FLJ22490; FLJ38886; |
Gene ID | 79848 |
mRNA Refseq | NM_024790 |
Protein Refseq | NP_079066 |
MIM | 611654 |
UniProt ID | Q1MSJ5 |
Chromosome Location | 8q13.2 |
◆ Recombinant Proteins | ||
CSPP1-154H | Recombinant Human centrosome and spindle pole associated protein 1 Protein, His&Flag tagged | +Inquiry |
CSPP1-16H | Recombinant Human CSPP1 protein, GST-tagged | +Inquiry |
CSPP1-11636H | Recombinant Human CSPP1, GST-tagged | +Inquiry |
CSPP1-2026M | Recombinant Mouse CSPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSPP1-3985M | Recombinant Mouse CSPP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSPP1 Products
Required fields are marked with *
My Review for All CSPP1 Products
Required fields are marked with *