Recombinant Human CSRP2, His-tagged
Cat.No. : | CSRP2-26304TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa , |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-193 a.a. |
Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 164 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
Full Length : | Full L. |
Gene Name | CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ] |
Official Symbol | CSRP2 |
Synonyms | CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; |
Gene ID | 1466 |
mRNA Refseq | NM_001321 |
Protein Refseq | NP_001312 |
MIM | 601871 |
Uniprot ID | Q16527 |
Chromosome Location | 12q21.1 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; |
Function | metal ion binding; molecular_function; zinc ion binding; |
◆ Recombinant Proteins | ||
CSRP2-6761C | Recombinant Chicken CSRP2 | +Inquiry |
CSRP2-840HFL | Recombinant Full Length Human CSRP2 Protein, C-Flag-tagged | +Inquiry |
CSRP2-26304TH | Recombinant Human CSRP2, His-tagged | +Inquiry |
CSRP2-11140Z | Recombinant Zebrafish CSRP2 | +Inquiry |
CSRP2-5233H | Recombinant Human CSRP2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP2-7232HCL | Recombinant Human CSRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *