Recombinant Human CSRP2, His-tagged

• Cat.No.: CSRP2-26304TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa ,

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-193 a.a.
• Description: CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3.
• Conjugation: HIS
• Form: Lyophilised:Reconstitution with 164 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
• Full Length: Full L.

Gene Information

• Gene Name: CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
• Official Symbol: CSRP2
• Synonyms: CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM
• Gene ID: 1466
• mRNA Refseq: NM_001321
• Protein Refseq: NP_001312
• MIM: 601871
• Uniprot ID: Q16527
• Chromosome Location: 12q21.1
• Pathway: ATF-2 transcription factor network, organism-specific biosystem
• Function: metal ion binding; molecular_function; zinc ion binding