Recombinant Human CSRP2, His-tagged

Cat.No. : CSRP2-26304TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa ,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-193 a.a.
Description : CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 164 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Full Length : Full L.
Gene Name CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
Official Symbol CSRP2
Synonyms CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM;
Gene ID 1466
mRNA Refseq NM_001321
Protein Refseq NP_001312
MIM 601871
Uniprot ID Q16527
Chromosome Location 12q21.1
Pathway ATF-2 transcription factor network, organism-specific biosystem;
Function metal ion binding; molecular_function; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSRP2 Products

Required fields are marked with *

My Review for All CSRP2 Products

Required fields are marked with *

0
cart-icon