Recombinant Human CST3 protein, His-tagged
| Cat.No. : | CST3-3020H |
| Product Overview : | Recombinant Human CST3 protein(25-146 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-146 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CST3 cystatin C [ Homo sapiens ] |
| Official Symbol | CST3 |
| Synonyms | CST3; cystatin C; cystatin C (amyloid angiopathy and cerebral hemorrhage); cystatin-C; cystatin 3; cystatin-3; gamma-trace; post-gamma-globulin; bA218C14.4 (cystatin C); neuroendocrine basic polypeptide; ARMD11; MGC117328; |
| Gene ID | 1471 |
| mRNA Refseq | NM_000099 |
| Protein Refseq | NP_000090 |
| MIM | 604312 |
| UniProt ID | P01034 |
| ◆ Recombinant Proteins | ||
| CST3-1845H | Recombinant Human CST3 Protein (Gly26-Ala146), N-His tagged | +Inquiry |
| CST3-373M | Recombinant Mouse CST3 Protein, His-tagged | +Inquiry |
| CST3-2025H | Recombinant Human CST3 Protein, GST-tagged | +Inquiry |
| CST3-2744H | Recombinant Human CST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cst3-2748M | Recombinant Mouse Cst3 protein, His&Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CST3-4309H | Native Human CST3 Protein | +Inquiry |
| CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
| CST3-26152TH | Native Human CST3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
| CST3-2470MCL | Recombinant Mouse CST3 cell lysate | +Inquiry |
| CST3-127HKCL | Human CST3 Knockdown Cell Lysate | +Inquiry |
| CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST3 Products
Required fields are marked with *
My Review for All CST3 Products
Required fields are marked with *
