Recombinant Human CST6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CST6-1094H |
Product Overview : | CST6 MS Standard C13 and N15-labeled recombinant protein (NP_001314) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype. |
Molecular Mass : | 16.5 kDa |
AA Sequence : | MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CST6 cystatin E/M [ Homo sapiens (human) ] |
Official Symbol | CST6 |
Synonyms | CST6; cystatin E/M; cystatin-M; cystatin 6; cystatin M; cystatin-6; cystatin-E; cystatin M/E; cysteine proteinase inhibitor; |
Gene ID | 1474 |
mRNA Refseq | NM_001323 |
Protein Refseq | NP_001314 |
MIM | 601891 |
UniProt ID | Q15828 |
◆ Recombinant Proteins | ||
CST6-2029H | Recombinant Human CST6 Protein, GST-tagged | +Inquiry |
CST6-1857H | Recombinant Human CST6 Protein (Arg29-Met149), C-His tagged | +Inquiry |
CST6-3171H | Recombinant Human CST6, His tagged | +Inquiry |
CST6-26432TH | Recombinant Human CST6, His-tagged | +Inquiry |
Cst6-2346M | Recombinant Mouse Cst6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST6-1632MCL | Recombinant Mouse CST6 cell lysate | +Inquiry |
CST6-2990HCL | Recombinant Human CST6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST6 Products
Required fields are marked with *
My Review for All CST6 Products
Required fields are marked with *
0
Inquiry Basket