Recombinant Human CST6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CST6-1094H
Product Overview : CST6 MS Standard C13 and N15-labeled recombinant protein (NP_001314) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.
Molecular Mass : 16.5 kDa
AA Sequence : MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CST6 cystatin E/M [ Homo sapiens (human) ]
Official Symbol CST6
Synonyms CST6; cystatin E/M; cystatin-M; cystatin 6; cystatin M; cystatin-6; cystatin-E; cystatin M/E; cysteine proteinase inhibitor;
Gene ID 1474
mRNA Refseq NM_001323
Protein Refseq NP_001314
MIM 601891
UniProt ID Q15828

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST6 Products

Required fields are marked with *

My Review for All CST6 Products

Required fields are marked with *

0
cart-icon
0
compare icon