Recombinant Human CT83 Protein, His-B2M-tagged

Cat.No. : CT83-542H
Product Overview : Recombinant Human CT83 fused with His-B2M tag at the N-terminus was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Form : 10 mM Tris-HCl, 1 mM EDTA, pH8.0, 10% glycerol
Molecular Mass : 27 kDa
AA sequence : MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Purity : 90%
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Short term: 2 to 8 centigrade, one week from the date of receipt;
Long term: -20 to -80 centigrade, six months from the date of receipt.
Concentration : 0.6 mg/ml
Gene Name CT83 cancer/testis antigen 83 [ Homo sapiens ]
Official Symbol CT83
Synonyms KKLC1; CXorf61; KK-LC-1
Gene ID 203413
mRNA Refseq NM_001017978
Protein Refseq NP_001017978
MIM 300625
UniProt ID Q5H943

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CT83 Products

Required fields are marked with *

My Review for All CT83 Products

Required fields are marked with *

0
cart-icon