Recombinant Human CT83 Protein, His-B2M-tagged
Cat.No. : | CT83-542H |
Product Overview : | Recombinant Human CT83 fused with His-B2M tag at the N-terminus was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Form : | 10 mM Tris-HCl, 1 mM EDTA, pH8.0, 10% glycerol |
Molecular Mass : | 27 kDa |
AA sequence : | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
Purity : | 90% |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Short term: 2 to 8 centigrade, one week from the date of receipt; Long term: -20 to -80 centigrade, six months from the date of receipt. |
Concentration : | 0.6 mg/ml |
Gene Name | CT83 cancer/testis antigen 83 [ Homo sapiens ] |
Official Symbol | CT83 |
Synonyms | KKLC1; CXorf61; KK-LC-1 |
Gene ID | 203413 |
mRNA Refseq | NM_001017978 |
Protein Refseq | NP_001017978 |
MIM | 300625 |
UniProt ID | Q5H943 |
◆ Recombinant Proteins | ||
CT83-23H | Recombinant Human CT83 protein, MYC/DDK-tagged | +Inquiry |
CT83-174C | Recombinant Cynomolgus Monkey CT83 Protein, His (Fc)-Avi-tagged | +Inquiry |
CT83-3575HFL | Recombinant Full Length Human CT83 protein, Flag-tagged | +Inquiry |
CT83-2160H | Recombinant Human CT83 Protein, His-tagged | +Inquiry |
CT83-3422H | Recombinant Human CT83 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CT83 Products
Required fields are marked with *
My Review for All CT83 Products
Required fields are marked with *