Recombinant Human CT83 Protein, His-B2M-tagged

• Cat.No.: CT83-542H
• Product Overview: Recombinant Human CT83 fused with His-B2M tag at the N-terminus was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Form: 10 mM Tris-HCl, 1 mM EDTA, pH8.0, 10% glycerol
• Molecular Mass: 27 kDa
• AA sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
• Purity: 90%
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: Short term: 2 to 8 centigrade, one week from the date of receipt;
  Long term: -20 to -80 centigrade, six months from the date of receipt.
• Concentration: 0.6 mg/ml

Gene Information

• Gene Name: CT83 cancer/testis antigen 83 [ Homo sapiens ]
• Official Symbol: CT83
• Synonyms: KKLC1; CXorf61; KK-LC-1
• Gene ID: 203413
• mRNA Refseq: NM_001017978
• Protein Refseq: NP_001017978
• MIM: 300625
• UniProt ID: Q5H943