Recombinant Human CTAG1A Protein (1-180 aa), His-tagged
Cat.No. : | CTAG1A-1371H |
Product Overview : | Recombinant Human CTAG1A Protein (1-180 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-180 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.0 kDa |
AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
Official Symbol | CTAG1A |
Synonyms | ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1; |
Gene ID | 246100 |
mRNA Refseq | NM_139250 |
Protein Refseq | NP_640343 |
UniProt ID | P78358 |
◆ Recombinant Proteins | ||
CTAG1A-677H | Recombinant Human CTAG1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CTAG1A-5004H | Recombinant Human CTAG1A protein, hFc-Myc-tagged | +Inquiry |
CTAG1A-2072H | Recombinant Human CTAG1A Protein (Met1-Arg180), N-SUMO tagged | +Inquiry |
CTAG1A-4933H | Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTAG1A-1371H | Recombinant Human CTAG1A Protein (1-180 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *