Recombinant Human CTAG1A Protein (1-180 aa), His-tagged
| Cat.No. : | CTAG1A-1371H |
| Product Overview : | Recombinant Human CTAG1A Protein (1-180 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-180 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.0 kDa |
| AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
| Official Symbol | CTAG1A |
| Synonyms | ESO1; CT6.1; LAGE-2; LAGE2A; NY-ESO-1; |
| Gene ID | 246100 |
| mRNA Refseq | NM_139250 |
| Protein Refseq | NP_640343 |
| UniProt ID | P78358 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *
