Recombinant Human CTAG1A Protein, GST-tagged
Cat.No. : | CTAG1A-2048H |
Product Overview : | Human CTAG1A full-length ORF ( AAI60040.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ] |
Official Symbol | CTAG1A |
Synonyms | CTAG1A; cancer/testis antigen 1A; Cancer/Testis Antigen 1A; Autoimmunogenic Cancer/Testis Antigen NY-ESO-1; Cancer/Testis Antigen 6.1; L Antigen Family Member 2; LAGE-2; LAGE2A; CT6.1; ESO1; New York Esophageal Squamous Cell Carcinoma 1; Cancer/Testis Antigen 1-A; Cancer/Testis Antigen 1; CTAG1A CTAG1B; NY-ESO-1; LAGE2B; CTAG1; LAGE2; CTAG; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2 |
Gene ID | 246100 |
mRNA Refseq | NM_139250 |
Protein Refseq | NP_640343 |
MIM | 300657 |
UniProt ID | P78358 |
◆ Recombinant Proteins | ||
CTAG1A-2048H | Recombinant Human CTAG1A Protein, GST-tagged | +Inquiry |
CTAG1A-4933H | Recombinant Human CTAG1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTAG1A-5004H | Recombinant Human CTAG1A protein, hFc-Myc-tagged | +Inquiry |
CTAG1A-1371H | Recombinant Human CTAG1A Protein (1-180 aa), His-tagged | +Inquiry |
CTAG1A-2072H | Recombinant Human CTAG1A Protein (Met1-Arg180), N-SUMO tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTAG1A Products
Required fields are marked with *
My Review for All CTAG1A Products
Required fields are marked with *
0
Inquiry Basket