Recombinant Human CTAG1A Protein, GST-tagged

Cat.No. : CTAG1A-2048H
Product Overview : Human CTAG1A full-length ORF ( AAI60040.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
Molecular Mass : 46.2 kDa
AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTAG1A cancer/testis antigen 1A [ Homo sapiens (human) ]
Official Symbol CTAG1A
Synonyms CTAG1A; cancer/testis antigen 1A; Cancer/Testis Antigen 1A; Autoimmunogenic Cancer/Testis Antigen NY-ESO-1; Cancer/Testis Antigen 6.1; L Antigen Family Member 2; LAGE-2; LAGE2A; CT6.1; ESO1; New York Esophageal Squamous Cell Carcinoma 1; Cancer/Testis Antigen 1-A; Cancer/Testis Antigen 1; CTAG1A CTAG1B; NY-ESO-1; LAGE2B; CTAG1; LAGE2; CTAG; cancer/testis antigen 1; New York Esophageal Squamous Cell Carcinoma 1; autoimmunogenic cancer/testis antigen NY-ESO-1; cancer/testis antigen 1-A; cancer/testis antigen 6.1; l antigen family member 2
Gene ID 246100
mRNA Refseq NM_139250
Protein Refseq NP_640343
MIM 300657
UniProt ID P78358

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG1A Products

Required fields are marked with *

My Review for All CTAG1A Products

Required fields are marked with *

0
cart-icon
0
compare icon