Recombinant Human CTAG2 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CTAG2-146H
Product Overview : CTAG2 MS Standard C13 and N15-labeled recombinant protein (NP_758965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants.
Molecular Mass : 18.3 kDa
AA Sequence : MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQAPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CTAG2 cancer/testis antigen 2 [ Homo sapiens (human) ]
Official Symbol CTAG2
Synonyms CTAG2; cancer/testis antigen 2; CAMEL; CT2; CT6.2; CT6.2a; CT6.2b; ESO2; LAGE-1; LAGE2B; cancer/testis antigen 2; CTL-recognized antigen on melanoma; LAGE-1a protein; autoimmunogenic cancer/testis antigen NY-ESO-2; cancer/testis antigen 6.2; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; l antigen family member 1
Gene ID 30848
mRNA Refseq NM_172377
Protein Refseq NP_758965
MIM 300396
UniProt ID O75638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG2 Products

Required fields are marked with *

My Review for All CTAG2 Products

Required fields are marked with *

0
cart-icon