Recombinant Human CTAG2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CTAG2-146H |
Product Overview : | CTAG2 MS Standard C13 and N15-labeled recombinant protein (NP_758965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQAPSGQRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CTAG2 cancer/testis antigen 2 [ Homo sapiens (human) ] |
Official Symbol | CTAG2 |
Synonyms | CTAG2; cancer/testis antigen 2; CAMEL; CT2; CT6.2; CT6.2a; CT6.2b; ESO2; LAGE-1; LAGE2B; cancer/testis antigen 2; CTL-recognized antigen on melanoma; LAGE-1a protein; autoimmunogenic cancer/testis antigen NY-ESO-2; cancer/testis antigen 6.2; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; l antigen family member 1 |
Gene ID | 30848 |
mRNA Refseq | NM_172377 |
Protein Refseq | NP_758965 |
MIM | 300396 |
UniProt ID | O75638 |
◆ Recombinant Proteins | ||
CTAG2-2471H | Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged | +Inquiry |
CTAG2-492H | Recombinant Human CTAG2, His-tagged | +Inquiry |
CTAG2-146H | Recombinant Human CTAG2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTAG2-2751H | Recombinant Human CTAG2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG2-7217HCL | Recombinant Human CTAG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTAG2 Products
Required fields are marked with *
My Review for All CTAG2 Products
Required fields are marked with *
0
Inquiry Basket