Recombinant Human CTBP2
Cat.No. : | CTBP2-28021TH |
Product Overview : | Recombinant full length Human CTBP2 with N terminal proprietary tag; Predicted MWt 75.06 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 445 amino acids |
Description : | This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3 untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. |
Molecular Weight : | 75.060kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLD GRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAM MYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGT RVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTP HTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNRE HPNEQ |
Sequence Similarities : | Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. |
Gene Name | CTBP2 C-terminal binding protein 2 [ Homo sapiens ] |
Official Symbol | CTBP2 |
Synonyms | CTBP2; C-terminal binding protein 2; C-terminal-binding protein 2; ribeye; |
Gene ID | 1488 |
mRNA Refseq | NM_001329 |
Protein Refseq | NP_001320 |
MIM | 602619 |
Uniprot ID | P56545 |
Chromosome Location | 10q26.13 |
Pathway | Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | NAD binding; cofactor binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; protein binding; |
◆ Recombinant Proteins | ||
CTBP2-1864H | Recombinant Human CTBP2 Protein (Met1-Leu252), N-His tagged | +Inquiry |
CTBP2-2208HF | Recombinant Full Length Human CTBP2 Protein, GST-tagged | +Inquiry |
CTBP2-2040M | Recombinant Mouse CTBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTBP2-1451H | Recombinant Human CTBP2 protein, His & T7-tagged | +Inquiry |
Ctbp2-2352M | Recombinant Mouse Ctbp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTBP2-417HCL | Recombinant Human CTBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTBP2 Products
Required fields are marked with *
My Review for All CTBP2 Products
Required fields are marked with *