Recombinant Human CTCFL Protein, GST-tagged

Cat.No. : CTCFL-2058H
Product Overview : Human CTCFL partial ORF ( NP_542185, 193 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]
Molecular Mass : 36.85 kDa
AA Sequence : AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTCFL CCCTC-binding factor (zinc finger protein)-like [ Homo sapiens ]
Official Symbol CTCFL
Synonyms CTCFL; CCCTC-binding factor (zinc finger protein)-like; transcriptional repressor CTCFL; BORIS; cancer/testis antigen 27; CT27; dJ579F20.2; HMG-1L1; CTCF paralog; CTCF-like protein; BORIS-like protein; zinc finger protein CTCF-T; brother of the regulator of imprinted sites; putative high mobility group protein 1-like 1; putative high mobility group protein B1-like 1; CTCF-T; HMGB1L1; MGC163358; MGC169105; MGC169106;
Gene ID 140690
mRNA Refseq NM_080618
Protein Refseq NP_542185
MIM 607022
UniProt ID Q8NI51

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTCFL Products

Required fields are marked with *

My Review for All CTCFL Products

Required fields are marked with *

0
cart-icon
0
compare icon