Recombinant Human CTHRC1 protein, GST-tagged
| Cat.No. : | CTHRC1-28025TH |
| Product Overview : | Recombinant Human CTHRC1(32 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 32-141 a.a. |
| Description : | This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ] |
| Official Symbol | CTHRC1 |
| Synonyms | CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1; |
| Gene ID | 115908 |
| mRNA Refseq | NM_001256099 |
| Protein Refseq | NP_001243028 |
| MIM | 610635 |
| UniProt ID | Q96CG8 |
| Chromosome Location | 8q22.3 |
| Pathway | Noncanonical Wnt signaling pathway, organism-specific biosystem; Wnt signaling network, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| CTHRC1-2053M | Recombinant Mouse CTHRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTHRC1-3047H | Recombinant Human Collagen Triple Helix Repeat Containing 1 | +Inquiry |
| CTHRC1-1055H | Recombinant Human CTHRC1 protein, hFc-tagged | +Inquiry |
| CTHRC1-4024M | Recombinant Mouse CTHRC1 Protein | +Inquiry |
| Cthrc1-4533M | Recombinant Mouse Cthrc1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTHRC1-2448HCL | Recombinant Human CTHRC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTHRC1 Products
Required fields are marked with *
My Review for All CTHRC1 Products
Required fields are marked with *
