Recombinant Human CTHRC1 protein, GST-tagged

Cat.No. : CTHRC1-28025TH
Product Overview : Recombinant Human CTHRC1(32 a.a. - 141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 32-141 a.a.
Description : This locus encodes a protein that may play a role in the cellular response to arterial injury through involvement in vascular remodeling. Mutations at this locus have been associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcript variants have been described.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.62 kDa
AA Sequence : EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ]
Official Symbol CTHRC1
Synonyms CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1;
Gene ID 115908
mRNA Refseq NM_001256099
Protein Refseq NP_001243028
MIM 610635
UniProt ID Q96CG8
Chromosome Location 8q22.3
Pathway Noncanonical Wnt signaling pathway, organism-specific biosystem; Wnt signaling network, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTHRC1 Products

Required fields are marked with *

My Review for All CTHRC1 Products

Required fields are marked with *

0
cart-icon