Recombinant Human CTLA4 Protein, GST-tagged
| Cat.No. : | CTLA4-2075H |
| Product Overview : | Human CTLA4 partial ORF ( NP_005205, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ] |
| Official Symbol | CTLA4 |
| Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3; |
| Gene ID | 1493 |
| mRNA Refseq | NM_001037631 |
| Protein Refseq | NP_001032720 |
| MIM | 123890 |
| UniProt ID | P16410 |
| ◆ Recombinant Proteins | ||
| CTLA4-657R | Recombinant Rat CTLA4 Protein, Fc-tagged | +Inquiry |
| CTLA4-1061CAF488 | Recombinant Canine CTLA4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| CTLA4-8852CF | Active Recombinant Monkey CTLA4 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| Ctla4-1717M | Recombinant Mouse Ctla4, Fc-His | +Inquiry |
| Ctla4-1143RF | Recombinant Rat Ctla4 Protein, hFc-tagged, FITC conjugated | +Inquiry |
| ◆ Native Proteins | ||
| CTLA4-36M | Active Recombinant Mouse CTLA4 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
| CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
| CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *
