Recombinant Human CTLA4 protein, His-tagged
Cat.No. : | CTLA4-2754H |
Product Overview : | Recombinant Human CTLA4 protein(P16410)(37-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-162aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.6 kDa |
AA Sequence : | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ] |
Official Symbol | CTLA4 |
Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3; |
Gene ID | 1493 |
mRNA Refseq | NM_001037631 |
Protein Refseq | NP_001032720 |
UniProt ID | P16410 |
◆ Recombinant Proteins | ||
Ctla4-1143RF | Recombinant Rat Ctla4 Protein, hFc-tagged, FITC conjugated | +Inquiry |
Ctla4-5839M | Recombinant Mouse Ctla4 protein, His & T7-tagged | +Inquiry |
CTLA4-354C | Active Recombinant Cynomolgus/Rhesus CTLA4 protein, His-tagged | +Inquiry |
Ctla4-1144RAF488 | Recombinant Rat Ctla4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CTLA4-2233HAF555 | Recombinant Human CTLA4 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Native Proteins | ||
CTLA4-36M | Active Recombinant Mouse CTLA4 Homodimer Protein, His tagged | +Inquiry |
CTLA4-35H | Active Recombinant Human CTLA4 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTLA4 Products
Required fields are marked with *
My Review for All CTLA4 Products
Required fields are marked with *