Recombinant Human CTNNB1 protein(61-170 aa), C-His-tagged
| Cat.No. : | CTNNB1-2732H |
| Product Overview : | Recombinant Human CTNNB1 protein(P35222)(61-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 61-170 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNK |
| Gene Name | CTNNB1 catenin (cadherin-associated protein), beta 1, 88kDa [ Homo sapiens ] |
| Official Symbol | CTNNB1 |
| Synonyms | CTNNB1; catenin (cadherin-associated protein), beta 1, 88kDa; catenin (cadherin associated protein), beta 1 (88kD) , CTNNB; catenin beta-1; beta catenin; CTNNB; FLJ25606; FLJ37923; DKFZp686D02253; |
| Gene ID | 1499 |
| mRNA Refseq | NM_001098209 |
| Protein Refseq | NP_001091679 |
| MIM | 116806 |
| UniProt ID | P35222 |
| ◆ Recombinant Proteins | ||
| CTNNB1-2514H | Recombinant Human CTNNB1 Protein (2-781 aa), His-tagged | +Inquiry |
| CTNNB1-1875H | Recombinant Human CTNNB1 Protein (Ala2-Leu781), His tagged | +Inquiry |
| CTNNB1-01D | Recombinant Dog CTNNB1 Protein | +Inquiry |
| CTNNB1-682H | Recombinant Human CTNNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTNNB1-36H | Recombinant Human CTNNB1 protein, His/GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTNNB1-563HCL | Recombinant Human CTNNB1 cell lysate | +Inquiry |
| CTNNB1-001MCL | Recombinant Mouse CTNNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNB1 Products
Required fields are marked with *
My Review for All CTNNB1 Products
Required fields are marked with *
