Recombinant Human CTNNB1 protein(61-170 aa), C-His-tagged

• Cat.No.: CTNNB1-2732H
• Product Overview: Recombinant Human CTNNB1 protein(P35222)(61-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNK

Gene Information

• Gene Name: CTNNB1 catenin (cadherin-associated protein), beta 1, 88kDa [ Homo sapiens ]
• Official Symbol: CTNNB1
• Synonyms: CTNNB1; catenin (cadherin-associated protein), beta 1, 88kDa; catenin (cadherin associated protein), beta 1 (88kD) , CTNNB; catenin beta-1; beta catenin; CTNNB; FLJ25606; FLJ37923; DKFZp686D02253
• Gene ID: 1499
• mRNA Refseq: NM_001098209
• Protein Refseq: NP_001091679
• MIM: 116806
• UniProt ID: P35222