Recombinant Human CTNNB1 protein(61-170 aa), C-His-tagged

Cat.No. : CTNNB1-2732H
Product Overview : Recombinant Human CTNNB1 protein(P35222)(61-170 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 61-170 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNK
Gene Name CTNNB1 catenin (cadherin-associated protein), beta 1, 88kDa [ Homo sapiens ]
Official Symbol CTNNB1
Synonyms CTNNB1; catenin (cadherin-associated protein), beta 1, 88kDa; catenin (cadherin associated protein), beta 1 (88kD) , CTNNB; catenin beta-1; beta catenin; CTNNB; FLJ25606; FLJ37923; DKFZp686D02253;
Gene ID 1499
mRNA Refseq NM_001098209
Protein Refseq NP_001091679
MIM 116806
UniProt ID P35222

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNNB1 Products

Required fields are marked with *

My Review for All CTNNB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon