Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CTNNBIP1-5580H |
Product Overview : | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 9 kDa |
AA Sequence : | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | CTNNBIP1 |
Synonyms | CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT; |
Gene ID | 56998 |
mRNA Refseq | NM_020248 |
Protein Refseq | NP_064633 |
MIM | 607758 |
UniProt ID | Q9NSA3 |
◆ Recombinant Proteins | ||
CTNNBIP1-1844HFL | Recombinant Full Length Human CTNNBIP1 Protein, C-Flag-tagged | +Inquiry |
CTNNBIP1-11672H | Recombinant Human CTNNBIP1, GST-tagged | +Inquiry |
CTNNBIP1-5580H | Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTNNBIP1-28030TH | Recombinant Human CTNNBIP1, His-tagged | +Inquiry |
CTNNBIP1-2084H | Recombinant Human CTNNBIP1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTNNBIP1 Products
Required fields are marked with *
My Review for All CTNNBIP1 Products
Required fields are marked with *
0
Inquiry Basket