Recombinant Human CTNNBIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CTNNBIP1-5580H | 
| Product Overview : | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. | 
| Molecular Mass : | 9 kDa | 
| AA Sequence : | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | CTNNBIP1 catenin beta interacting protein 1 [ Homo sapiens (human) ] | 
| Official Symbol | CTNNBIP1 | 
| Synonyms | CTNNBIP1; catenin, beta interacting protein 1; beta-catenin-interacting protein 1; beta catenin interacting protein ICAT; ICAT; inhibitor of beta catenin and Tcf 4; MGC15093; inhibitor of beta-catenin and Tcf-4; beta-catenin-interacting protein ICAT; | 
| Gene ID | 56998 | 
| mRNA Refseq | NM_020248 | 
| Protein Refseq | NP_064633 | 
| MIM | 607758 | 
| UniProt ID | Q9NSA3 | 
| ◆ Recombinant Proteins | ||
| CTNNBIP1-2318HF | Recombinant Full Length Human CTNNBIP1 Protein, GST-tagged | +Inquiry | 
| CTNNBIP1-683H | Recombinant Human CTNNBIP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CTNNBIP1-5635C | Recombinant Chicken CTNNBIP1 | +Inquiry | 
| CTNNBIP1-11672H | Recombinant Human CTNNBIP1, GST-tagged | +Inquiry | 
| CTNNBIP1-3377H | Recombinant Human CTNNBIP1 Protein, MYC/DDK-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNBIP1 Products
Required fields are marked with *
My Review for All CTNNBIP1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            