Recombinant Human CTPS protein, His-tagged
Cat.No. : | CTPS-11676H |
Product Overview : | Recombinant Human CTPS protein(242-591 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 242-591 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CTPS CTP synthase [ Homo sapiens ] |
Official Symbol | CTPS |
Synonyms | CTPS; CTP synthase; CTP synthase , CTPS; CTP synthase 1; CTP synthetase 1; UTP--ammonia ligase 1; cytidine 5-triphosphate synthetase; cytidine 5-prime triphosphate synthetase; |
Gene ID | 1503 |
mRNA Refseq | NM_001905 |
Protein Refseq | NP_001896 |
MIM | 123860 |
UniProt ID | P17812 |
◆ Recombinant Proteins | ||
Ctps-2364M | Recombinant Mouse Ctps Protein, Myc/DDK-tagged | +Inquiry |
CTPS-28031TH | Recombinant Human CTPS, His-tagged | +Inquiry |
CTPS-11676H | Recombinant Human CTPS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTPS-7197HCL | Recombinant Human CTPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTPS Products
Required fields are marked with *
My Review for All CTPS Products
Required fields are marked with *
0
Inquiry Basket