Recombinant Human CTPS1 Protein (1-591 aa), His-tagged
Cat.No. : | CTPS1-1753H |
Product Overview : | Recombinant Human CTPS1 Protein (1-591 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-591 aa |
Description : | This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 68.7 kDa |
AA Sequence : | MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | CTPS1 CTP synthase 1 [ Homo sapiens (human) ] |
Official Symbol | CTPS1 |
Synonyms | CTPS; GATD5; IMD24; |
Gene ID | 1503 |
mRNA Refseq | NM_001301237 |
Protein Refseq | NP_001288166 |
UniProt ID | P17812 |
◆ Recombinant Proteins | ||
CTPS1-2321HF | Recombinant Full Length Human CTPS1 Protein, GST-tagged | +Inquiry |
CTPS1-685H | Recombinant Human CTPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTPS1-3379H | Recombinant Human CTPS1 Protein, MYC/DDK-tagged | +Inquiry |
CTPS1-1137H | Recombinant Human CTPS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTPS1-2092H | Recombinant Human CTPS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTPS1 Products
Required fields are marked with *
My Review for All CTPS1 Products
Required fields are marked with *
0
Inquiry Basket