Recombinant Human CTRL, His-tagged
Cat.No. : | CTRL-69H |
Product Overview : | Recombinant Human Chymotrypsin-Like Protease CTRL-1/CTRL produced by transfected human cells is a secreted protein with sequence (Ile33-Asn264) of Human CTRL fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 33-264 a.a. |
Description : | Chymotrypsin-Like Protease CTRL-1 is a protease that belongs to the peptidase S1 family. Human CTRL-1 is synthesized as a 264 amino acid (aa) precursor that contains an 18 aa signal sequence, 15 aa activation peptide and a 231 aa mature chain. CTRL-1 Contains 1 peptidase S1 domain. It has many molecular functions, such as hydrolase, protease, and serine protease. CTRL-1 plays a role in digest and hydrolyze proteins in biological process. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0 |
AA Sequence : | CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRH FVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEA LTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGD SGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYNVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
CTRL-3368H | Recombinant Human CTRL Protein | +Inquiry |
CTRL-336H | Recombinant Human CTRL, His tagged | +Inquiry |
CTRL-3372H | Recombinant Human CTRL Protein, MYC/DDK-tagged | +Inquiry |
CTRL-2098H | Recombinant Human CTRL Protein, GST-tagged | +Inquiry |
CTRL-11681H | Recombinant Human CTRL, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRL-1011HCL | Recombinant Human CTRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTRL Products
Required fields are marked with *
My Review for All CTRL Products
Required fields are marked with *
0
Inquiry Basket