| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
33-264 a.a. |
| Description : |
Chymotrypsin-Like Protease CTRL-1 is a protease that belongs to the peptidase S1 family. Human CTRL-1 is synthesized as a 264 amino acid (aa) precursor that contains an 18 aa signal sequence, 15 aa activation peptide and a 231 aa mature chain. CTRL-1 Contains 1 peptidase S1 domain. It has many molecular functions, such as hydrolase, protease, and serine protease. CTRL-1 plays a role in digest and hydrolyze proteins in biological process. |
| Form : |
Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0 |
| AA Sequence : |
CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRH FVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEA LTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGD SGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYNVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Store at Please minimize freeze-thaw cycles. |